SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013796 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013796
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.06e-46
Family VHS domain 0.00019
Further Details:      
 
Domain Number 2 Region: 178-253
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-21
Family SH3-domain 0.0000553
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013796
Domain Number - Region: 287-354
Classification Level Classification E-value
Superfamily GAT-like domain 0.0419
Family GAT domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013796   Gene: ENSMMUG00000010527   Transcript: ENSMMUT00000014728
Sequence length 513
Comment pep:known chromosome:MMUL_1:12:15791217:15821720:-1 gene:ENSMMUG00000010527 transcript:ENSMMUT00000014728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPHVALQALTLLGAC
VANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEFQKDPQFSLISAT
IKSMKEEGITFPPAGSQTVCCLEKEVTTDWNGEEGKELKTSIELSLQEQKQQHTETKSLY
PSAEIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFP
SNFVTTNLNVETEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRALQVLQSIDPTDS
KPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALELYNKLVNEAPVYS
VYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSLGPDQIGPLRSLP
PNVNSSVTTQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQN
TTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL
Download sequence
Identical sequences 9544.ENSMMUP00000013796 ENSMMUP00000013796 ENSMMUP00000013796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]