SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013829 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013829
Domain Number 1 Region: 6-155
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.83e-41
Family VHS domain 0.0000277
Further Details:      
 
Domain Number 2 Region: 166-290
Classification Level Classification E-value
Superfamily GAT-like domain 9.68e-28
Family GAT domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013829   Gene: ENSMMUG00000010550   Transcript: ENSMMUT00000014761
Sequence length 464
Comment pep:known chromosome:MMUL_1:16:39161984:39220556:1 gene:ENSMMUG00000010550 transcript:ENSMMUT00000014761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPKDAVKALKKRI
SKNYNHKEIQLTLSLIDMCVQNCGPSFQTLIVKKEFVKENLVKLLNPRYNLPLDIQNRIL
NFIKAWSQGFPGGVDVSEVKEVYLDLLKKGVQFPPSEAEAETARQETAQISSNPPTSVPT
APALSSVIAPKNSTITLVPEQIGKLHSELDMVKMNVRVMSAILMENTPGSENHEDIELLQ
KLYKTGREMQERIMDLLVVVENEDVTVELIQVNEDLNNAILGYERFTRNQQRILEQNNQK
EATSTTSEPSAPSQDLLDLSPSPRMPRDTLGELNTMNNQLSDLNFSSPSSDVTNNLKPSL
HPQMDLLALENTEIPLFSQRISQNLTSSHAYDNPVSLQTTAAAPSNQSLPPLPSNHPAMT
KSDLQPPNYYEVMEFDPLAPAVTTEAIYEEIDAHQHKGTENHGD
Download sequence
Identical sequences 9544.ENSMMUP00000013829 ENSMMUP00000013829 ENSMMUP00000013829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]