SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013839 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013839
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000000119
Family TAP-C domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013839   Gene: ENSMMUG00000010552   Transcript: ENSMMUT00000014771
Sequence length 258
Comment pep:known chromosome:MMUL_1:2:103729537:103751375:1 gene:ENSMMUG00000010552 transcript:ENSMMUT00000014771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLD
RKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQE
FMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAY
WNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLID
DFVEFARPQIAGTKSTTV
Download sequence
Identical sequences A0A287BB12 F6Q8L6 G1T369 M1EMA2
ENSOCUP00000010659 ENSPTRP00000026947 ENSGGOP00000010499 ENSECAP00000018953 ENSOCUP00000010659 ENSPTRP00000026947 ENSMMUP00000013839 9544.ENSMMUP00000013839 9598.ENSPTRP00000026947 9796.ENSECAP00000018953 9986.ENSOCUP00000010659 ENSMMUP00000013839 ENSECAP00000018953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]