SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013873 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013873
Domain Number 1 Region: 81-154
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000798
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013873   Gene: ENSMMUG00000010586   Transcript: ENSMMUT00000014808
Sequence length 272
Comment pep:known chromosome:MMUL_1:7:69375949:69377394:-1 gene:ENSMMUG00000010586 transcript:ENSMMUT00000014808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPLCPPLSESWMLSAAWGPTRRPPPSDRDCGRSLVSSPDSCGSTPADSPVPSAARPGS
RLDPRAPTVGKRGARSSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQSL
TKIETLRLAIRYIGHLSAVLGLSEESLQRQRRRRQRGDAGSPWGCPLCPDGCPAQTQTRT
QAEGQRQGQGRRLGLVSAVRAGASWGSLPACPGARAVPEPRDLPALFAEAACSEGQVMEP
SPPSPLLPGDVLALLETWMPLSPLEWLPEEPK
Download sequence
Identical sequences F7CHQ1
XP_001093487.1.72884 ENSMMUP00000013873 9544.ENSMMUP00000013873 ENSMMUP00000013873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]