SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013920 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013920
Domain Number 1 Region: 95-154
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013920   Gene: ENSMMUG00000010621   Transcript: ENSMMUT00000014857
Sequence length 215
Comment pep:known chromosome:MMUL_1:6:150845479:150848757:-1 gene:ENSMMUG00000010621 transcript:ENSMMUT00000014857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGG
PPPAAAAAAAAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELREC
IPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRD
LQQHEGFPPALGPGEKRIKGRTGWPQQVWALELNQ
Download sequence
Identical sequences A0A2K5M528 A0A2K5X7Y9 A0A2K5YE46 A0A2K6C689 F7BK41
ENSMMUP00000013920 XP_001111722.1.72884 XP_005558413.1.63531 XP_011740764.1.29376 XP_011836637.1.47321 XP_011924276.1.92194 ENSMMUP00000013920 9544.ENSMMUP00000013920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]