SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013924 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013924
Domain Number 1 Region: 184-263
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000264
Family PHD domain 0.011
Further Details:      
 
Domain Number 2 Region: 40-90
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000158
Family Tudor domain 0.0074
Further Details:      
 
Domain Number 3 Region: 92-159
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000012
Family PHD domain 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013924
Domain Number - Region: 557-578
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0367
Family Chromo domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013924   Gene: ENSMMUG00000010623   Transcript: ENSMMUT00000014862
Sequence length 580
Comment pep:known chromosome:MMUL_1:15:15129535:15147826:1 gene:ENSMMUG00000010623 transcript:ENSMMUT00000014862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENRALDPGTRDSYGATSHLPNKGALAKVKNNFRDLMSKLTEGQYVLCRWTDGLYYLGKI
KRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCG
LGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRKGGALKKGAIARTLQAVKMVLSYQP
EELEWDSPHRTNQQQCYCYCGGPGEWYLRMLQCYRCRQWFHEACTQCLNEPMMFGDRFYL
FFCSVCNQGPEYIERLPLRWVDVVHLALYNLGVQSKKKYFDFEEILAFVNHHWELLQLGK
LTSTPVTDRGPHLLNALNSYKSRFLCGKEIKKKKCIFRLRIRVPPNPPGKLLPDKGLLPN
ENSASSELRKRGKSKPGLLPHEFQQQKRRVYRRKRSKFLLEDAIPSSDFTSAWSTNHHLA
SIFDFTLDEIQSLKSASSGQTFFSDVDSTDAASTSGSASTSLSYDSRWTVGSRKRKLAAK
AYMPLRAKRWAAELDGRCPSDSSAEGASVPERPDEGIDSHTFESISEDDSSLSHLKSSIT
NYFGAAGRLACGEKYQVLARRVTPEGKVQYLVEWEGTTPY
Download sequence
Identical sequences A0A096P0Q5 A0A0D9RL81 A0A1D5QU71 A0A2K6CCQ8 A0A2K6PR51 G7PRJ6
ENSPANP00000018930 ENSMMUP00000013924 XP_005580981.1.63531 XP_007966418.1.81039 XP_007966419.1.81039 XP_007966420.1.81039 XP_010370322.1.97406 XP_011748760.1.29376 XP_011748761.1.29376 XP_011782792.1.43180 XP_011782793.1.43180 XP_014972429.1.72884 ENSMMUP00000013924 9544.ENSMMUP00000013924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]