SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013999 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013999
Domain Number 1 Region: 167-525
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.69e-119
Family beta-N-acetylhexosaminidase catalytic domain 0.00000000000143
Further Details:      
 
Domain Number 2 Region: 23-166
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 2.09e-41
Family beta-N-acetylhexosaminidase domain 0.000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013999   Gene: ENSMMUG00000010687   Transcript: ENSMMUT00000014941
Sequence length 529
Comment pep:known chromosome:MMUL_1:7:50933518:50968309:-1 gene:ENSMMUG00000010687 transcript:ENSMMUT00000014941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSRLWFSLLLAAAFAGRATALWPWPQNIQTSDQRYVLYPNNFQFQYDISSAAQPGCSV
LDEAFQRYRDLLFGSGSWPRPYRTGKRHTPEKNVLVVSVVTPGCNQLPTLESVENYTLTI
NDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHY
LPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVK
EVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEF
MSTFFLEISSVFPDFYLHLGGDEVDFTCWKSNPDIQDFMRKKGFGEDFKQLESFYIQTLL
DIVSSYGKGYVVWQEVFDNKVKIRPDTIIQVWREEIPVNYMKELELVTKAGFRALLSAPW
YLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV
AERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLHVGYCEQEFEQT
Download sequence
Identical sequences A0A2K6BCN7 I0FR94 Q4R6G5
9544.ENSMMUP00000014005 NP_001248458.1.72884 XP_011749131.1.29376 ENSMMUP00000014005 ENSMMUP00000013999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]