SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014050 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014050
Domain Number 1 Region: 7-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.06e-21
Family APC10-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014050   Gene: ENSMMUG00000010723   Transcript: ENSMMUT00000014995
Sequence length 138
Comment pep:known chromosome:MMUL_1:19:18850104:18851583:-1 gene:ENSMMUG00000010723 transcript:ENSMMUT00000014995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVS
QLQIQFQGGFSSRRGCLEGSQGSQALRKIADFYPEDSNSLQYPAPASGVDRLKVTFEDAT
DFFGRVVIYHLRVLGEKV
Download sequence
Identical sequences ENSMMUP00000014050 ENSMMUP00000014050 9544.ENSMMUP00000014050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]