SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014076 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014076
Domain Number 1 Region: 42-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000012
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014076   Gene: ENSMMUG00000010745   Transcript: ENSMMUT00000015024
Sequence length 243
Comment pep:known chromosome:MMUL_1:8:110327839:110492916:-1 gene:ENSMMUG00000010745 transcript:ENSMMUT00000015024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFRLFSFALIILNCMDYSHCQGNRWRRSKRVVYVSNPICKGCLSCSKDNGCSRCQQKLF
FFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLH
RGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKP
AKDTIPCPTIAESRRCKMAMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDR
ANQ
Download sequence
Identical sequences ENSMMUP00000014076 9544.ENSMMUP00000014076 ENSMMUP00000014076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]