SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014079 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014079
Domain Number 1 Region: 142-366
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.44e-51
Family Regulator of chromosome condensation RCC1 0.0058
Further Details:      
 
Domain Number 2 Region: 763-868
Classification Level Classification E-value
Superfamily POZ domain 8.79e-21
Family BTB/POZ domain 0.0085
Further Details:      
 
Domain Number 3 Region: 539-641
Classification Level Classification E-value
Superfamily POZ domain 5.3e-17
Family BTB/POZ domain 0.016
Further Details:      
 
Domain Number 4 Region: 28-116
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000182
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014079   Gene: ENSMMUG00000010749   Transcript: ENSMMUT00000015027
Sequence length 1346
Comment pep:known chromosome:MMUL_1:4:78215327:78285976:-1 gene:ENSMMUG00000010749 transcript:ENSMMUT00000015027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPMPDCTSKCRSLKHALDVLSVVTKGSENQIKAFLSSHCYNAATIKDVFGRNALHLVS
SCGKKGVLDWLIQKGVDLLVKDKESGWTALHRSIFYGHIDCVWSLLKHFVGPRWKDHLSP
GSEDQPGQHSQTLKEARNKYPTDVYTWGDNTNFTLGHGSQNSKHHPEVVDLFSRSGIYIK
QVVLCKFHSVFLSQKGQVYTCGHGPGGRLGHGDEQTCLVPRLVEGLNGHSCSQVAAAEDH
TVVLTEDGCVYTFGLNIFHQLGIIPPPSSCNVPRQIQAKYLKGRTIIGVAAGRFHTVLWT
REAVYTMGLNGGQLGCLLDPNGEKCVTAPRQVSALHHKDIALSLVAASDGATVCVTTRGD
IYLLADYQCKKMASKQLNLKKVLVSGGHMEYKVDPEHLKENGSQICILAMDGAGRVFCWR
SVNSSMKQCRWAYPRQVFISDIALNKNEILFVTQDGEGFRGRWFEEKRKSSEKKEILSNL
HNSSSDVSYVSDINSVYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIPAV
SSSSFFEEFGKLLRETDEMDSIHDVTFQVGNRLFPAHKYILAVRSDFFQKLFLSDGSTSE
FTDIYRKDEDSAGCHLFVVEKVHPDMFEYLLQFIYTDTCDFLTHGFKPRIHLNKNPEEYQ
GTLNSHLNEVNFHEDDNQKSAFEVYKSNQAQTVSERQKSKPKSCKKGKNIRGDDPVRMLQ
TVAKEFGFSNLSSRLDGVRFENEKINVIAKKTGNKLKLSQKKCSFLCDVTMKSVDGKEFP
CHKCVLCARLEYFHSMLSSSWIEASSCAALEMPIHSDILKVILDYLYTDEAVVIKESQNV
DFICSVLVVADQLLITRLKEICEVALTEKLTLKNAAMLLEFAAMYNAKQLKLSCLQFIGL
NMAALLEARSLDVLSDGVLKDLSEFYRKMIPAMDRRVITPYQDGPDISYLEVEDGDIFLK
EEINMEQNHSETMFKKAKTKAKKKPRKRSDSSGGYNLSDIIQSPSSTGLLKSGKTNSMAY
CHKILLFIIITSYVLLSRCSLTSFIFFFSPQTKVKPYVNGASPMYAREDLKPWEKSPILK
ISAPQPIPNNRIDTTNSASWVAGSFSPVSPPVVDLRTIMEIEESRQKCGATPKSHLGKTA
SHGVKLSQKQRKMIALTTKENNLGMNSMETVLSTPSKAPKPVNAWASSLHSVSSKSFRDF
LLEEKKSVTSHSSGDHVKKVSFKGIENSQAPKIVRCSTHGAPGPEGNHISDLPLLDSPNP
WLSSSVTAPSMVAPVTFASIVEEELQQEAALIRSREKPLALIQIEEHAIQDLLVFYEAFG
NPEEFVIVERTPQGPLAVPMWNKHGC
Download sequence
Identical sequences 9544.ENSMMUP00000014079 ENSMMUP00000014079 ENSMMUP00000014079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]