SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014361 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014361
Domain Number 1 Region: 20-266
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.36e-25
Family Haloperoxidase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014361   Gene: ENSMMUG00000010949   Transcript: ENSMMUT00000015323
Sequence length 308
Comment pep:known chromosome:MMUL_1:7:43432505:43460654:-1 gene:ENSMMUG00000010949 transcript:ENSMMUT00000015323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFF
RQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAE
YTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADA
IDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYK
LYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGS
LGINQEEQ
Download sequence
Identical sequences A0A096NMC6 A0A0D9RJN8 A0A1D5QGQ8 A0A2K5I8B5 A0A2K5NX21 A0A2K6DEX3 A0A2K6KCI4 A0A2K6N822 G8F5Q6
XP_001101919.2.72884 XP_005559860.1.63531 XP_008014459.1.81039 XP_010353792.1.97406 XP_010353794.1.97406 XP_011751029.1.29376 XP_011795791.1.43180 XP_011948152.1.92194 XP_014997953.1.72884 XP_017740590.1.44346 XP_017740591.1.44346 ENSMMUP00000014361 ENSMMUP00000014361 ENSPANP00000014135 9544.ENSMMUP00000014361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]