SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014371 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014371
Domain Number 1 Region: 231-523
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-76
Family Kelch motif 0.0000124
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily POZ domain 8.37e-19
Family BTB/POZ domain 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014371
Domain Number - Region: 160-239
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0889
Family B3/B4 domain of PheRS, PheT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014371   Gene: ENSMMUG00000010959   Transcript: ENSMMUT00000015335
Sequence length 549
Comment pep:known chromosome:MMUL_1:15:55702535:55706219:1 gene:ENSMMUG00000010959 transcript:ENSMMUT00000015335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDFIYTAKLSLNMDNLQDTLEA
ASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTG
EFLKLPFERLAFVLSSNSLKHCTELELFKAACRWLRLEDPRMDYAAKLMKNIRFPLMTPQ
DLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHLVTLGGVLR
QQLVVSKELRMYDERAQEWRSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDT
VFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYNPRMNEWSY
VAKMSEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWMQKAPMTTVRGLHCM
CTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIY
VVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRES
PLSAPSDHS
Download sequence
Identical sequences Q7Z350
ENSPTRP00000040495 HR6051 ENSPTRP00000040495 XP_011785730.1.43180 XP_011832976.1.47321 9544.ENSMMUP00000014371 ENSMMUP00000014371 ENSP00000437733 ENSMMUP00000014371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]