SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014378 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014378
Domain Number 1 Region: 88-207
Classification Level Classification E-value
Superfamily PX domain 1.27e-31
Family PX domain 0.00064
Further Details:      
 
Domain Number 2 Region: 263-434
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000942
Family IMD domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014378   Gene: ENSMMUG00000010966   Transcript: ENSMMUT00000015344
Sequence length 437
Comment pep:known chromosome:MMUL_1:15:23245837:23365022:-1 gene:ENSMMUG00000010966 transcript:ENSMMUT00000015344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGPPKALPSTGHRTGRDMPHPLAGSSREEAVGGDSTPSPDLLMARSFGDKDLILPNGG
TPAGTSSPASSSSLLNRLQLDDDIDGETRDLFVIVDDPKKHVCTMETYITYRITTKSTRV
EFDLPEYSVRRRYQDFDWLRSKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKAL
DKFLKRITDHPVLSFNEHFNVFLTAKDLNAYKKQGIALLTRMGESVKHVTGGYKLRTRPL
EFAAIGDYLDTFALKLGTIDRIAQRIIKEEIEYLVELREYGPVYSTWSALEGELAEPLEG
VSACIGNCSTALEELTDDMTEDFLPVLREYILYSDSMKSVLKKRDQVQAEYEAKLEAVAL
RKEDRPKVPADVEKCQDRMECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYEKCL
MAWESIIPLLQEKQEAK
Download sequence
Identical sequences ENSMMUP00000014378 9544.ENSMMUP00000014378 ENSMMUP00000014378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]