SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014379 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014379
Domain Number 1 Region: 191-374
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-53
Family SPRY domain 0.0000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014379   Gene: ENSMMUG00000010967   Transcript: ENSMMUT00000015345
Sequence length 387
Comment pep:known chromosome:MMUL_1:5:180231778:180245535:-1 gene:ENSMMUG00000010967 transcript:ENSMMUT00000015345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCGIQEAAENYRKLFQEILNTSREKLEAAKSILTDEQERMAMIQEEEQNFKKMIESEYSM
RLRLLDEECELNLQRQQECTSDLNLREGLLNQVIQLATELEEMFQEMLQRLSHVGRENMK
KLKESEARVSEQICSLQKLTTELEKKCGEDALALLKNAKYSLERSKSLLLERLEPAHIID
LSLCHIRGFSSMFRVLQRHLTLDPETAHPCLALSEDLRTVKLRHGQQDGAGDPGRLDFSA
MVLAAESFTSGRHYWEVDVEKATRWQVGIFHGSADTKGSTARASGEKVLLTGSVMGTEWT
LWVFPPLKRLFLKKKLDTVGIFLDYEHGQISFYNVTETSLIYSFSHCAFQGALRPVFSLC
IPNGDTSPDSLTISPQHGPSCDAAVSP
Download sequence
Identical sequences G7P6P9
ENSMMUP00000014379 9544.ENSMMUP00000014379 ENSMMUP00000014379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]