SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014401 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014401
Domain Number 1 Region: 295-596
Classification Level Classification E-value
Superfamily Kelch motif 1.07e-48
Family Kelch motif 0.0028
Further Details:      
 
Domain Number 2 Region: 31-147
Classification Level Classification E-value
Superfamily POZ domain 1.99e-30
Family BTB/POZ domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014401   Gene: ENSMMUG00000010989   Transcript: ENSMMUT00000015370
Sequence length 612
Comment pep:known chromosome:MMUL_1:14:104659023:104680271:-1 gene:ENSMMUG00000010989 transcript:ENSMMUT00000015370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELAMDNSYAFNQRSTCNGIPSEKKNNFLVSEDHGQKILSVLQNFREQNVFYDFKIIMKD
EIIPCHRCVLAACSDFFRAMFEVNMKERDDGSVTITNLSSKAVKAFLDYAYTGKTKITDD
NVEMFFQLSSFLQVSFLSKACSDFLIKSINLVNCLQLLSISDSYGSTSLFDHALHFVQHH
FSLLFKSSDFLEMNFGVLQKCLESDELNVPEEEMVLKVVLSWTKHNLESRQKYLPHLIEK
VRLHQLSEETLQDCLFNEESLLKSTDCFDIIMDAIKCVQGSGGLFPDARPSTTEKYIFIH
KTEENGENQYTFCYNIKTDSWKILPQSHLIDLPGSSLSSYGEKIFLTGGCKGKCCRTVRL
HIAESYHDATDQTWCYCPVKNDFFLVSTMKTPRTMHTSVMALDRLFVIGGKTRGSRDIKS
LLDVESYNPLSKEWISVSPLPRGIYYPEASACQNVIYVLGSEVEITDAFNPSLDCFFKYN
ATTDQWSELVAEFGQFFHATLIKAVPVNCTLYICDLSTYKVYSFCPDTCVWKGEGSFECA
GFNAGAIGIEDKIYILGGDYAPDEITDEVQVYHSNRSEWEEVSPMPRALTEFYCQVIQFN
KYRDPWFSNLCA
Download sequence
Identical sequences A0A0D9S2A9 A0A2K5IZI7 A0A2K5UT83 A0A2K6MDX4 A0A2K6QJY8 F7GS68
NP_001247684.1.72884 XP_005579568.1.63531 XP_005579569.1.63531 XP_008018908.1.81039 XP_008018909.1.81039 XP_008018911.1.81039 XP_008018912.1.81039 XP_010361095.1.97406 XP_010361096.1.97406 XP_011782047.1.43180 XP_011782048.1.43180 XP_014971063.1.72884 XP_014971064.1.72884 XP_015291143.1.63531 XP_015291144.1.63531 XP_017704347.1.44346 XP_017704348.1.44346 XP_017704349.1.44346 ENSMMUP00000014401 ENSMMUP00000036732 ENSMMUP00000014401 9544.ENSMMUP00000014401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]