SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014407 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014407
Domain Number 1 Region: 352-613
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.96e-77
Family Protein kinases, catalytic subunit 0.000000000248
Further Details:      
 
Domain Number 2 Region: 6-146
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-45
Family Pleckstrin-homology domain (PH domain) 0.0000515
Further Details:      
 
Domain Number 3 Region: 234-382
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-32
Family SH2 domain 0.0000018
Further Details:      
 
Domain Number 4 Region: 175-256
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-17
Family SH3-domain 0.0000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014407   Gene: ENSMMUG00000010995   Transcript: ENSMMUT00000015377
Sequence length 620
Comment pep:known chromosome:MMUL_1:6:153553557:153628514:1 gene:ENSMMUG00000010995 transcript:ENSMMUT00000015377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVMHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWMDGKWRCCSQLEKLAAGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALY
DYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKSISRDKAEKLLWDTGKEGAFMVRDSRTPGTYTVSVFTKAVVSENNPCIKHYHIKETND
NPKRYYVAEKFVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE
DRPAFSRLLRQLAEIAESGL
Download sequence
Identical sequences A0A096MS14 A0A0D9RE75 A0A2K5LNC1 A0A2K6A5N1 A0A2K6AVK0 F7GS57 G7P6R0
NP_001253373.1.72884 XP_005558441.1.63531 XP_008013328.1.81039 XP_011740726.1.29376 XP_011822101.1.47321 XP_011906198.1.92194 ENSMMUP00000014407 ENSMMUP00000014407 9544.ENSMMUP00000014407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]