SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014421 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000014421
Domain Number - Region: 11-72
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00298
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014421   Gene: ENSMMUG00000011012   Transcript: ENSMMUT00000015395
Sequence length 75
Comment pep:known scaffold:MMUL_1:1099214343012:58:780:1 gene:ENSMMUG00000011012 transcript:ENSMMUT00000015395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVKKSPGKHLSQLENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSL
LHTLYGRIFNLGYVT
Download sequence
Identical sequences ENSMMUP00000014421 ENSMMUP00000014421 9544.ENSMMUP00000014421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]