SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014466 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014466
Domain Number 1 Region: 65-351
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.77e-101
Family GatB/GatE catalytic domain-like 0.000000389
Further Details:      
 
Domain Number 2 Region: 375-480
Classification Level Classification E-value
Superfamily GatB/YqeY motif 7.43e-26
Family GatB/GatE C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014466   Gene: ENSMMUG00000011048   Transcript: ENSMMUT00000015443
Sequence length 557
Comment pep:known chromosome:MMUL_1:5:143896573:143981501:-1 gene:ENSMMUG00000011048 transcript:ENSMMUT00000015443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPMLRWVGRGRLWTFARVDGGSCHRREAPTGSTSNWIRGQSSVAQQPLYMTQKPRKGE
HKWAAVVGLEIHAQISSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPVLNRRCVEAAV
MTGLALNCHINKKSLFDRKHYFYADLPAGYQITQQRLPIAVNGSLTYGVCAGKKQSQVIP
KTVRIKQIQLEQDSGKSLHDDLRSQTLIDLNRAGVGLLEVVLEPDLSCGEEAATAVRELQ
LILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSIRFLAKAIDYEIQRQI
NELENGGEILNETRSFHYQLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYDATSLPAGADP
QQVINIDQIRETLPELPSVTRERLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAEPK
KVTSWVLNTFLGYLKQQNLAVSESPVTPSALAELLDLLDSRTISSAAAKQVFEELWKREG
KTPGQIVSEKQLELMEDRGALEQLCHSMMEAHPQVVMDLKKGNPRAINKLIGLVRKATQS
RADPAMIKEILEKKLSS
Download sequence
Identical sequences F7GP33
ENSMMUP00000014466 9544.ENSMMUP00000014466 XP_001083960.1.72884 ENSMMUP00000014466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]