SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014510 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014510
Domain Number 1 Region: 22-96,218-320,441-574
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.84e-38
Family Quinoprotein alcohol dehydrogenase-like 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014510
Domain Number - Region: 342-482
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0447
Family Quinohemoprotein amine dehydrogenase B chain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014510   Gene: ENSMMUG00000011080   Transcript: ENSMMUT00000015492
Sequence length 830
Comment pep:known chromosome:MMUL_1:12:53108641:53145427:1 gene:ENSMMUG00000011080 transcript:ENSMMUT00000015492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEEENIRVVRCGGSELNFRRAVFSADSKYIFCVSGDFVKVYSTVTEECVHILHGHRNLV
TGIQLNPNNHLQLYSSSLDGTIKLWDYIDGILIKTFTVGCKLHALFTVAQAEDSVFAIVN
KEKPDIFQLVSVKLPKSSSQEVEAKELSFVLDYINQSPKCIAFGNEGVYVAAVREFYLSV
YFFKKKTTSRFTLSSSRNKKHAKNNFTCVACHPTEDCIASGHMDGKIRLWRNFYDDKKYT
YTCLHWHHDMVMDLAFSVTGTSLLSGGRESVLVEWRDATEKNKEFLPRLGATIEHISVSP
AGDLFCTSHSDNKVIIIHRNLEASAVIQGLVKDRSIFTGLMIDPRTKALVLNGKPGHLQF
YSLQSDKQLYNLDIIQQEYINDYGLIQIELTKAAFGCFGNWLATVEQRQEKETELELQMK
LWMYNKKTQGFILNTKINMPHEDCITALCFCNAEKSEQPTLVTASKDGYFKVWILTDDSD
IYKKAVGWTCDFVGSYHKYQATNCCFSEDGSLLAVSFEEIVTIWDSITWELKCTFCQRAG
KIRHLCFGRLTCSKYLLGATENGILCCWNLLSCALEWNAKLNVRVMEPDPNSENIAAISQ
SSVGSDLFVFKPSEPRPLYIQKGISREEVQWGVFVPRDVPESFTSEAYQWLNRSQFYFLT
KSQSLLTFSTKSPEEKLTPTSKQLLAEESLPTTPFYFILGKHRQLQDEKLNETLENELVQ
LPLTENIPAVSELLHTPAHVLPSAAFLCSMFVNSLLLSKETKSAKEIPEDVDMEEEKESE
DSDEENDFIEKVQDTNNTGLGEDIIHQLSKSEEKELRKFRKIDYSWIAAL
Download sequence
Identical sequences F7FX33
ENSMMUP00000014510 ENSMMUP00000014510 9544.ENSMMUP00000014510 XP_001106363.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]