SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014539 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014539
Domain Number 1 Region: 59-180
Classification Level Classification E-value
Superfamily PX domain 4.58e-22
Family PX domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014539
Domain Number - Region: 223-342
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00178
Family Arfaptin, Rac-binding fragment 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014539   Gene: ENSMMUG00000011106   Transcript: ENSMMUT00000015524
Sequence length 446
Comment pep:known chromosome:MMUL_1:2:45429997:45508535:-1 gene:ENSMMUG00000011106 transcript:ENSMMUT00000015524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQAPRDPERQLQPAPLEPLGCPDAGLGAAIGKEAAGAGEEDSGVDTMTHNNFWLKKIEI
SVSEAEKRTGRNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRNYLLVY
YPQTILNAEFVWHKLSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLFLTQEGN
WKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQSVISHLLRVRARVAD
RLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHYADQLKE
YLFYAEALRCRAVCRKHELMQYDLEMAAQDLASKKQQCEELATGTVRTFSLKGMTTKLFG
QETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKEALIS
YAVMQISMCKKGIQVWTNAKECFSKM
Download sequence
Identical sequences ENSMMUP00000014539 9544.ENSMMUP00000014539 ENSMMUP00000014539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]