SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014578 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014578
Domain Number 1 Region: 89-390
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.99e-59
Family Carboxylesterase 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014578   Gene: ENSMMUG00000011137   Transcript: ENSMMUT00000015565
Sequence length 407
Comment pep:known chromosome:MMUL_1:1:15773658:15796108:1 gene:ENSMMUG00000011137 transcript:ENSMMUT00000015565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPWLVLLLALPIFFLGVFVWAVFEHFLTTDVPATLQHPAKLRFLHCIFLYLITLGNIF
EKLGICSMPKFIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG
GGTVFGSLDCYHGLCNYLARETDSVLLMIGYRKVPDHHSPALFQDCMNASIHFLKALETY
GVDPSRVVVCGDSIGGAVVAAITQALVGRSDLPRIRAQVLIYPFVQAFCLQLPSYQQNQN
VPFLSRKFLVTSVCNYLAIDLSWRDAILNGTCVPPDVWRKYEKWLSPDNIPKKFKNRGYQ
PWSPGPFNEAAYLEAKHMLDVENSPLIADDEVIAQLPESFLVSCENDILRDDSLLYKKRL
EDQGVRVTWYHLEDGFHGSVIFFDKKALFFPCSLKIVNAVVSYVKGI
Download sequence
Identical sequences G7NU68
ENSMMUP00000014578 9544.ENSMMUP00000014578 ENSMMUP00000014578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]