SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014592 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014592
Domain Number 1 Region: 2-121,245-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.08e-39
Family FAD-linked reductases, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014592   Gene: ENSMMUG00000011148   Transcript: ENSMMUT00000015579
Sequence length 368
Comment pep:known chromosome:MMUL_1:7:137048645:137056673:1 gene:ENSMMUG00000011148 transcript:ENSMMUT00000015579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVS
DRVTVLYRSKAIRYTWPCPFPMADSSPWVHITLGDGSTFQTKLLIGADGHNSGVRQAAGI
QNVSWNYDQSAVVATLHLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAQ
LVSMDEEKFVDAVNSAFWSDADHTDFIDTAGAMLQYAVGLLKPTKVSARQLPPSVARVDA
KSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGDISSLAHHLSTAAFNG
KDLGSMSHLTGYETERQRHNTALLAATDLLKRLYSTSAAPLVLLRTWGLQATNAVSPLKE
QIMAFASK
Download sequence
Identical sequences ENSMMUP00000014592 9544.ENSMMUP00000014592 ENSMMUP00000014592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]