SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014613 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000014613
Domain Number - Region: 25-124
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000243
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014613   Gene: ENSMMUG00000031207   Transcript: ENSMMUT00000015602
Sequence length 302
Comment pep:known chromosome:MMUL_1:14:7927006:7935129:-1 gene:ENSMMUG00000031207 transcript:ENSMMUT00000015602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFHRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTM
NLLEQHSRGLQAVMTGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTR
GGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQ
TDLYLLRLRAARAYLQALESSLSPMSATAREPLKLHAVVQGLGPTFKLTLHLQNTSTARP
VLGLLVCCLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVGATLVPC
GR
Download sequence
Identical sequences G7NC53 G7PP91
ENSMMUP00000014613 ENSMMUP00000014613 9544.ENSMMUP00000014613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]