SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014736 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014736
Domain Number 1 Region: 295-592
Classification Level Classification E-value
Superfamily Kelch motif 6.02e-73
Family Kelch motif 0.0000267
Further Details:      
 
Domain Number 2 Region: 22-141
Classification Level Classification E-value
Superfamily POZ domain 6.8e-33
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014736   Gene: ENSMMUG00000011243   Transcript: ENSMMUT00000015730
Sequence length 616
Comment pep:known chromosome:MMUL_1:20:82781120:82792925:1 gene:ENSMMUG00000011243 transcript:ENSMMUT00000015730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEGSRQTRVSRPYKISESSKVYRWADHSSTVLQRLNEQRLRGLFCDIVLVADEQRVPAH
RNLLAVCSDYFNSMFTIGMREAFQKEVELIGASYIGLKAVVDFLYGGELVLDGGNIDYVL
ETAHLLQIWTVVDFCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSF
TPDFLQNVSMQKLCVYLSSSEVQRECEHDLLQAALQWLTQQPEREAHARQVLENIHFPLI
PKNDLLHRVKPAVCSLLPKEANCEGFIEEAVRYHNNLAAQPVMQTKRTALRTNQERLLFV
GGEVSERCLELSDDTCYLDAKSEQWVKETPLPARRSHHCVAVLGGFIFIAGGSFSRDNGG
DAASNLLYRYDPRCKQWIKVASMNQRRVDFYLASIEDMLVAVGGRNENGALSSVETYSPK
TDSWSYVAGLPRFTYGHAGTIYKDFVYISGGHDYQIGPYRKNLLCYDHRTDVWEERRPMT
TARGWHSMCSLGDSIYSIGGSDDNIESMERFDVLGVEAYSPQCNQWTRVAPLLHANSESG
VAVWEGRIYILGGYSWENTAFSKTVQVYDREADKWSRGVDLPKAIAGGSACVCALEPRPE
DKKKKGKGKRHQDRGQ
Download sequence
Identical sequences A0A096NPH1 A0A0D9S1X1 A0A2K5M7F8 A0A2K5VUK0 A0A2K5YUL8 A0A2K6BF68 A0A2K6PAH4 F6WWV1
ENSMMUP00000014736 ENSPANP00000014901 ENSMMUP00000014736 9544.ENSMMUP00000014736 XP_005592737.1.63531 XP_007992426.1.81039 XP_007992427.1.81039 XP_010353928.1.97406 XP_011765678.1.29376 XP_011765679.1.29376 XP_011765680.1.29376 XP_011765681.1.29376 XP_011826793.1.47321 XP_011937549.1.92194 XP_011937634.1.92194 XP_014982207.1.72884 XP_014982208.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]