SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014752 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014752
Domain Number 1 Region: 306-575
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-66
Family Kelch motif 0.0000458
Further Details:      
 
Domain Number 2 Region: 23-142
Classification Level Classification E-value
Superfamily POZ domain 1.49e-31
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014752   Gene: ENSMMUG00000011258   Transcript: ENSMMUT00000015748
Sequence length 589
Comment pep:known chromosome:MMUL_1:7:65369763:65371532:-1 gene:ENSMMUG00000011258 transcript:ENSMMUT00000015748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSVHETRKSRSSTGSMNVTLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCH
RAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENAESL
LEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVR
QSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKAHLPELLRSVRLAL
LPSDCLQEAVSSEALLMADERTKLIIDEALRCKTRILQNDGVVTSPCARPRKAGHTLLIL
GGQTFMCDKIYQVDHKAKEIIPKADLPSPRKEFSASAIGCKVYVTGGRGSENGVSKDVWV
YDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPG
ANKWMMVAPLRDGVSNAAVVSAKLKLFVFGGTSIHRDMVSKVQCYDPAENRWTIKAECPQ
PWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKL
YVVGGYFGTQRCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPA
Download sequence
Identical sequences A0A2K6B1B5 F6WPV8 G7P9D2
ENSMMUP00000014752 ENSMMUP00000014752 9544.ENSMMUP00000014752 NP_001245044.1.72884 XP_005560473.1.63531 XP_005560474.1.63531 XP_005560475.1.63531 XP_011750645.1.29376 XP_011750646.1.29376 XP_011750647.1.29376 XP_011750648.1.29376 XP_011750649.1.29376 XP_011750650.1.29376 XP_014998418.1.72884 XP_014998419.1.72884 XP_015308827.1.63531 XP_015308828.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]