SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014864 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014864
Domain Number 1 Region: 306-392
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000982
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000144
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.034
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000641
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014864   Gene: ENSMMUG00000011330   Transcript: ENSMMUT00000015863
Sequence length 591
Comment pep:known chromosome:MMUL_1:19:53348260:53372444:1 gene:ENSMMUG00000011330 transcript:ENSMMUT00000015863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPYPGSGGGSEVKCVGGRGASVPWDFLPGLMVKAPSGPCLQAQRKEKSRNAARSRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLG
PGRRGPAALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVEMTGS
SVFDYIHPGDHSEVLEQLGLRTPTPGPPTPPSVSSSSSSSSSSLADTPEIEASLTKVPPS
SLVQERSFFVRMKSTLTKRGLHVKASGYKVIHVTGRLRAHALGLVALGHTLPPAPLAELP
LHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSHVDLLD
KGQVMTGYYRWLRRAGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAEGGQTPLDAFQ
LPASVACEEASSPGPEPTELEPPTEGKQAAPAENEVPQTQGKRIKVEPSPRETKGSEDSG
DEDPSGHPATPRPEFTSVIRAGVLKQDPVRPWGLAPPGDPPPALLHAGFLPPVVRGLCTP
GTIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD
Download sequence
Identical sequences A0A2K6D1Z7
ENSMMUP00000019485 XP_001112801.1.72884 XP_011734362.1.29376 XP_014979816.1.72884 ENSMMUP00000014864 9544.ENSMMUP00000019485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]