SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014942 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014942
Domain Number 1 Region: 728-1089
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.18e-106
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000000000207
Further Details:      
 
Domain Number 2 Region: 526-725
Classification Level Classification E-value
Superfamily ARM repeat 6.33e-62
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00000000343
Further Details:      
 
Domain Number 3 Region: 351-524
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.07e-54
Family PLC-like (P variant) 0.00000004
Further Details:      
 
Domain Number 4 Region: 145-321
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-52
Family Ras-binding domain, RBD 0.0000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014942   Gene: ENSMMUG00000011385   Transcript: ENSMMUT00000015944
Sequence length 1102
Comment pep:known chromosome:MMUL_1:3:144283523:144325187:1 gene:ENSMMUG00000011385 transcript:ENSMMUT00000015944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELENYEQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLH
VAGHGNVEQMKAQVWLRALETSMASDFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKATHRSPGQIHLVQRRPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGL
VTPRMAEVASRDPRLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDT
PGTILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPAVSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEY
VLHMWQISGKGEDQGSFSADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLP
KSFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDTCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
Download sequence
Identical sequences A0A2K6DNW0 F6W7C8 G7P2F4
ENSMMUP00000014942 ENSMMUP00000014942 NP_001253687.1.72884 XP_005550530.1.63531 XP_005550531.1.63531 XP_005550532.1.63531 XP_011728764.1.29376 XP_011728765.1.29376 XP_011728766.1.29376 XP_011728767.1.29376 XP_014990084.1.72884 XP_014990085.1.72884 9544.ENSMMUP00000014942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]