SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014980 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014980
Domain Number 1 Region: 156-276
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000000179
Family Glyoxalase I (lactoylglutathione lyase) 0.024
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00000000691
Family Glyoxalase I (lactoylglutathione lyase) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014980   Gene: ENSMMUG00000011417   Transcript: ENSMMUT00000015985
Sequence length 313
Comment pep:known chromosome:MMUL_1:16:550016:571954:-1 gene:ENSMMUG00000011417 transcript:ENSMMUT00000015985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRALHFVFKVGNRFQTARFYRDVLGMKTESCSVAQAGCNGATGFHCSDYTRITEDSF
STPYDGKWSKTMVGFGPEDDHFVAELTYNYGIGDYKLGNDFMGITLASSQAVSNARKLEW
PLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLHKSLNYWCDLLGMKIYE
KDEEKQRALLGYADNQCKLELQGVKGAVEHAAAFGRIAFSCPQKELPDLEDLMKRENQKI
LTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKVDPEGSKLLDDAMAADKSD
EWFAKHNKPKASG
Download sequence
Identical sequences ENSMMUP00000014980 9544.ENSMMUP00000014980 ENSMMUP00000014980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]