SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015016 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015016
Domain Number 1 Region: 263-346
Classification Level Classification E-value
Superfamily E set domains 6.16e-20
Family E-set domains of sugar-utilizing enzymes 0.09
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015016
Domain Number - Region: 353-403
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0125
Family HLH, helix-loop-helix DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015016   Gene: ENSMMUG00000011447   Transcript: ENSMMUT00000016023
Sequence length 596
Comment pep:known chromosome:MMUL_1:9:129455661:129476861:-1 gene:ENSMMUG00000011447 transcript:ENSMMUT00000016023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQENIPRGGTTMKEEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGV
RTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTML
VWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRL
QKVIPRHPGDPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHN
QIPTLGNTPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQ
SNYNTVSTSMNGYGSGAMANLGVPGSPGFLNGSSANSPYGIVPSSPTMAASSVTLPSNCS
STHGIFSFSPANVISAVKQKSAFAPVVRPQASPPPSCTSANGNGLQAMSGLVVPPM
Download sequence
Identical sequences A0A2J8TAH7 A0A2K5KRR6 A0A2K6KKD8 A0A2K6PH48 D4A274 F7B409 O08791
ENSRNOP00000021702 ENSMUSP00000033378 ENSMUSP00000101724 10090.ENSMUSP00000101724 10116.ENSRNOP00000021702 9544.ENSMMUP00000015017 ENSRNOP00000021702 NP_001101976.1.100692 NP_001101976.1.4139 NP_001106886.1.92730 XP_004265754.1.21590 XP_004625627.1.9945 XP_005566807.1.63531 XP_006230525.1.100692 XP_007962627.1.81039 XP_010386927.1.97406 XP_011721179.1.29376 XP_011946669.1.92194 XP_012636864.1.48125 XP_013358559.1.28644 XP_014701884.1.49734 XP_015861577.1.50099 XP_017393363.1.71028 XP_017730796.1.44346 XP_019583823.1.88060 XP_021078229.1.100879 ENSMMUP00000015017 ENSMUSP00000101724 ENSMMUP00000015016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]