SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015026 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015026
Domain Number 1 Region: 210-277
Classification Level Classification E-value
Superfamily Homeodomain-like 4.02e-21
Family Homeodomain 0.0034
Further Details:      
 
Domain Number 2 Region: 97-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000137
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 66-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000457
Family LIM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015026   Gene: ENSMMUG00000011453   Transcript: ENSMMUT00000016033
Sequence length 363
Comment pep:known chromosome:MMUL_1:15:13776290:13802325:1 gene:ENSMMUG00000011453 transcript:ENSMMUT00000016033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGALDKDEGRASPCTPSTPSVCSPPSAAS
SVPSAGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIFCK
MDYFSRFGTKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVL
CRIHYDTMIENLKRAAENGNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQ
DNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDD
IHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVIL
FQY
Download sequence
Identical sequences 9544.ENSMMUP00000015026 XP_007966363.1.81039 XP_007966364.1.81039 ENSMMUP00000015026 ENSMMUP00000015026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]