SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015058 from Macaca mulatta 69_1

(show help)
Strong hits

Sequence:	ENSMMUP00000015058
Domain Number 1	Region: 137-184
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	4.28e-16
Family	LIM domain	0.0011
Further Details:

Domain Number 2	Region: 17-65
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	8.83e-16
Family	LIM domain	0.00078
Further Details:

Domain Number 3	Region: 97-136
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000087
Family	LIM domain	0.0069
Further Details:

Weak hits

Sequence:	ENSMMUP00000015058
Domain Number -	Region: 1-16
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0903
Family	LIM domain	0.014
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSMMUP00000015058 Gene: ENSMMUG00000011475 Transcript: ENSMMUT00000016067
Sequence length	193
Comment	pep:known chromosome:MMUL_1:7:168842199:168844046:1 gene:ENSMMUG00000011475 transcript:ENSMMUT00000016067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	AEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGS YIYEKPLAEGPQVTPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYF AEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGS YIYDRDPEGKVQP
Download sequence
Identical sequences	9544.ENSMMUP00000015058 ENSMMUP00000015058 ENSMMUP00000015058

SEARCH