SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015059 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015059
Domain Number 1 Region: 32-169
Classification Level Classification E-value
Superfamily PX domain 7.72e-16
Family PX domain 0.0058
Further Details:      
 
Domain Number 2 Region: 202-401
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000942
Family BAR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015059   Gene: ENSMMUG00000011476   Transcript: ENSMMUT00000016068
Sequence length 404
Comment pep:known chromosome:MMUL_1:10:51263743:51290135:-1 gene:ENSMMUG00000011476 transcript:ENSMMUT00000016068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQS
PEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHAILSKDRNFHVFLEYDQDLSVRRKNTK
EMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE
LINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
Download sequence
Identical sequences A0A2K5WXX6 A0A2K6E630 F7AE06
ENSMMUP00000015060 ENSMMUP00000037449 NP_001244488.1.72884 XP_005568336.1.63531 XP_011748225.1.29376 XP_015005011.1.72884 XP_015313258.1.63531 ENSMMUP00000015059 9544.ENSMMUP00000037449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]