SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015062 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015062
Domain Number 1 Region: 186-356
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000317
Family Carboxylesterase/thioesterase 1 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015062   Gene: ENSMMUG00000011477   Transcript: ENSMMUT00000016071
Sequence length 793
Comment pep:known chromosome:MMUL_1:13:97010274:97057603:-1 gene:ENSMMUG00000011477 transcript:ENSMMUT00000016071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPMPLYDNQKARSVMNECERHVIFARTDADAPPPPEDWEEHVNRTGWTMAQNKLFNKI
LKALQSDRLARLANEGACNEPVLRRVAVDKCARRVRQALASVSWDTKLIQWLHTTLVETL
SLPMLAAYLDALQTLKGKIPTLIDRMLVSSNTKTGAAGAEALSLLLKRPWDPAVGVLSHN
KPSKLPGSPLILIASSGPSSSVFPTSRRHRFWQSQLSCLGKVIPVATHLLNNGSGVGVLQ
CLEHMIGAVRSKVLEIHSHFPHKPIILIGWNTGALVACHVSVMEYVTAVVCLGFPLLTVD
GPRGDVDDPLLDMKTPVLFVIGQNSLQCHPEAMEDFREKIRAENSLVVVGGADDNLRISK
AKKKSEGLTQSMVDRCIQDEIVDFLTGVLTRAEGHMGSEPRDQDAEKKKKPRDVARRDLA
FEVPERGSRPASPAAKLPASPSGSEDLSSVSSSPTSSPKTKVTAVTSAQKSSQIGSSQLL
KRHVQRTEAMLTHKQAQVPISSEPPEEGEKEDLRVQLKRHHPSSPLPGSKTSKRPKIKVS
LISQGDTAGGPCAASQGSAPEGGKPITMTLGQASAGAKELTGLLTTAKSSSSEGGVSASP
APSVVSSSTAPSALHTLQSRLVATSPGSSLPGATSASSLLQGLSFSLQDISSKTSGLPAN
PSPGPAPQATSVKLPTPMQSLGAITTGTSTIVRTIPVATTLSSLGATPGGKPTAIHQLLT
NGGLAKLASSLPGLAQISHQASGLKVPTTITLTLRGQPSRITTLSPMGSGAAPSEEPSSQ
VLPSSSQRLPPAP
Download sequence
Identical sequences ENSMMUP00000015062 9544.ENSMMUP00000015062 ENSMMUP00000015062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]