SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015095 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015095
Domain Number 1 Region: 15-76
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000837
Family SNARE fusion complex 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015095   Gene: ENSMMUG00000011505   Transcript: ENSMMUT00000016108
Sequence length 111
Comment pep:known chromosome:MMUL_1:14:16010:18192:-1 gene:ENSMMUG00000011505 transcript:ENSMMUT00000016108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDF
TSMTGLLTGSVKRFSAMARSGRDNRKLLCGMAVGLIVAFFILSYFLSRART
Download sequence
Identical sequences A0A096NPV1 A0A0D9RFY1 A0A2K5NRA5 A0A2K5URK7 A0A2K6BSB7 H9FN01
ENSMMUP00000015095 ENSPANP00000015039 NP_001244540.1.72884 XP_005576757.1.63531 XP_007964971.1.81039 XP_011760542.1.29376 XP_011896308.1.92194 ENSMMUP00000015095 9544.ENSMMUP00000015095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]