SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015149 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015149
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily SNARE-like 3.48e-32
Family Synatpobrevin N-terminal domain 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015149
Domain Number - Region: 121-148
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0497
Family SNARE fusion complex 0.008
Further Details:      
 
Domain Number - Region: 164-225
Classification Level Classification E-value
Superfamily Serum albumin-like 0.0916
Family Serum albumin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015149   Gene: ENSMMUG00000002015   Transcript: ENSMMUT00000016164
Sequence length 258
Comment pep:known chromosome:MMUL_1:X:153833847:153885052:1 gene:ENSMMUG00000002015 transcript:ENSMMUT00000016164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRI
VYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSEN
KGLDKVMETQAQVDELKGIMVRNIVCHLQNYQQKSCSSHVYEEPQAHDHYHHRINCIHLY
HCLTSLWWIYMAKLCEEIKKLSLTKDMREQGVKSNPCDSSLSHTDRWYLPVSSTLFSLFK
ILFHASRFTFVLSTSLFP
Download sequence
Identical sequences ENSMMUP00000002698 9544.ENSMMUP00000002698 ENSMMUP00000015149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]