SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015175 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015175
Domain Number 1 Region: 9-279
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-90
Family Protein kinases, catalytic subunit 0.00000196
Further Details:      
 
Domain Number 2 Region: 353-412
Classification Level Classification E-value
Superfamily NTF2-like 0.0000000000000321
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.0000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015175   Gene: ENSMMUG00000011563   Transcript: ENSMMUT00000016193
Sequence length 412
Comment pep:known chromosome:MMUL_1:6:146707953:146768706:-1 gene:ENSMMUG00000011563 transcript:ENSMMUT00000016193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATITCTRFTEEYQLFEELGNGSFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFEN
Download sequence
Identical sequences ENSMMUP00000015175 9544.ENSMMUP00000033861 ENSMMUP00000033861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]