SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015440 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015440
Domain Number 1 Region: 18-178,220-282
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-69
Family BAR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 301-311,346-403
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000499
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015440   Gene: ENSMMUG00000011759   Transcript: ENSMMUT00000016481
Sequence length 404
Comment pep:known chromosome:MMUL_1:15:9822393:9842270:1 gene:ENSMMUG00000011759 transcript:ENSMMUT00000016481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQT
EVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAE
AEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAK
AAEAKATVDSGTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTR
LLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGSSQGAIFPGTFVGTTEP
ASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADS
SELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
Download sequence
Identical sequences ENSMMUP00000015440 ENSMMUP00000015442 9544.ENSMMUP00000015442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]