SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015493 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015493
Domain Number 1 Region: 1090-1214
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-32
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 25-145
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-32
Family Cadherin 0.00092
Further Details:      
 
Domain Number 3 Region: 469-572
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 250-372
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-28
Family Cadherin 0.00087
Further Details:      
 
Domain Number 5 Region: 991-1102
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-28
Family Cadherin 0.00046
Further Details:      
 
Domain Number 6 Region: 668-777
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-27
Family Cadherin 0.0031
Further Details:      
 
Domain Number 7 Region: 771-879
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 362-468
Classification Level Classification E-value
Superfamily Cadherin-like 2e-25
Family Cadherin 0.00096
Further Details:      
 
Domain Number 9 Region: 575-672
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-22
Family Cadherin 0.0026
Further Details:      
 
Domain Number 10 Region: 875-991
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-21
Family Cadherin 0.0029
Further Details:      
 
Domain Number 11 Region: 133-254
Classification Level Classification E-value
Superfamily Cadherin-like 7.59e-17
Family Cadherin 0.0024
Further Details:      
 
Domain Number 12 Region: 1200-1299
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000186
Family Cadherin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015493   Gene: ENSMMUG00000011807   Transcript: ENSMMUT00000016540
Sequence length 1345
Comment pep:known chromosome:MMUL_1:5:117646869:117653368:1 gene:ENSMMUG00000011807 transcript:ENSMMUT00000016540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTGPGARGSPGELKRLCDWEGAVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVA
AADADEGTNADIRYRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSL
TGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSSAANGN
ISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQ
ARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYS
IVSGNGLGWFHISEHSGLVTTGAAGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLL
DVNDEKPRFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFR
LDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMTRINVSLLDINDNSPVFYPVQ
YFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSRFQVNVQSGVISTRMALDR
EEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFGQVAYSFVVFENVALGYHVG
SVSASTMDLNSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASGGTV
TGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLK
QNPKNLFAINGKNGTISLLGPLDVQAGSYQIEILASDMGVPQLSSSVILTVYVHDVNDNS
PVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPDGQLY
IKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQ
RAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHTISGEITNTYQFDRESLMRRRGTA
VFSFTVIATDQGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVS
ASDVDEGNNGLIHYSIIKGNEERQFAIDITSGQVALIGKLDYEATPAYSLVIQAVDSGTI
PLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYS
ITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMNVTILVTDL
NDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEVEYEIINGDTDTFIVDRYSG
DLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTIILQGLDGPVFTQPKYITILKEGE
PIGTNVISIEAASPRGSEAPVEYYI
Download sequence
Identical sequences 9544.ENSMMUP00000015493 ENSMMUP00000015493 ENSMMUP00000015493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]