SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015506 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015506
Domain Number 1 Region: 485-565,592-757
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.73e-28
Family beta 1,4 galactosyltransferase (b4GalT1) 0.016
Further Details:      
 
Domain Number 2 Region: 148-296
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000461
Family Spore coat polysaccharide biosynthesis protein SpsA 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015506   Gene: ENSMMUG00000011819   Transcript: ENSMMUT00000016555
Sequence length 791
Comment pep:known chromosome:MMUL_1:7:81301836:81374832:-1 gene:ENSMMUG00000011819 transcript:ENSMMUT00000016555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLGLVLGFVLASRLVLPRASELKRAGPRRRASPEGCRSGQAAASQAGGARGDARGAQLW
SPGSDPDGGPRDRNFLFVGVMTAQKYLQTRAVAAYRTWSKTIPGKVQFFSSEGSDTSIPI
PIVPLRGVDDSYPPQKKSFMMLKYMHDHYLDKYEWFMRADDDVYIKGDRLENFLRSLNSS
EPLFLGQTGLGTTEEMGKLALEPGENFCMGGPGVIMSREVLRRMVPHIGKCLREMYTTHE
DVEVGRCVRRFAGVQCVWSYEMQQLFYENYEQNKKGYIRDLHNSKIHQAITLHPNKNPPY
QYRLHSYMLSRKIAELRHRTIQLHREIVLMSKYSNTEIHKEDLQLGIPPSFMRFQPRQRE
EILEWEFLTGKYLYSAVDGQPPRRGMDSAQREALDDIVMQVMEMINANAKTRGRIIDFKE
IQYGYRRVNPMYGAEYILDLLLLYKKHKGKKMTVPVRRHAYLQQTFSKIQFVEHEELDAQ
ELAKRINQESGSLSFLSNSLKKLVPFQLPGSKNEHKEPKDKKINILIPLSGRFDMFVRFM
GNFEKTCLIPNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQILPVSGEFSRA
LALEVGSSQFSNESLLFFCDVDLVFTTEFLQRCRANTVLGQQIYFPIIFSQYDPKIVYSG
KVPSDNHFAFTQKTGFWRNYGFGITCIYKGDLVRAGGFDVSIQGWGLEDVDLFNKVVQAG
LKTFRSQEVGVVHVHHPVFCDPNLDPKQYKMCLGSKASTYGSTQQLAEMWLEKNDPSYSK
SSNNNGSVRTA
Download sequence
Identical sequences 9544.ENSMMUP00000015506 ENSMMUP00000015506 ENSMMUP00000015506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]