SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015522 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015522
Domain Number 1 Region: 82-391
Classification Level Classification E-value
Superfamily Subtilisin-like 6.81e-84
Family Subtilases 0.00000000216
Further Details:      
 
Domain Number 2 Region: 387-537
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-41
Family Proprotein convertase P-domain 0.00018
Further Details:      
 
Domain Number 3 Region: 593-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.08e-34
Family Growth factor receptor domain 0.00028
Further Details:      
 
Domain Number 4 Region: 732-841
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.00081
Further Details:      
 
Domain Number 5 Region: 1-43
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000167
Family Prohormone convertase 1 pro-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015522   Gene: ENSMMUG00000011829   Transcript: ENSMMUT00000016571
Sequence length 869
Comment pep:known chromosome:MMUL_1:7:81427578:81566962:-1 gene:ENSMMUG00000011829 transcript:ENSMMUT00000016571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQETESEFRAPLHKQGSAW
QEGRNIPGSFGLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNY
VSQSLEPNVGDYSYSNRFSRNGSFRHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLD
GDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSI
FVWASGNGGREGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYE
RKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANGQLTWRDVQHLLVKTSRPAHLKA
SDWKVNGAGHKVSHFYGFGLVDAEALVVEAKKWTAVPSQHMCVAASDKRPRSIPLVQVLR
TTALTSACAEHSDQRVVYLEHVVVRISISHPRRGDLQIYLISPSGTKSQLLAKRLLDLSN
EGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTF
SAHQSRSRMLELTAPELEPPKAALSPSQMEVPEDEEDYTAHSTPGSANILQTSVCHPECG
DKGCDGPNADQCLNCIHFSLGSVKTSRKCVSVCPLGYFGDTAARRCRRCHKGCETCSGRG
ATQCLSCRRGFYHHQEMNTCVTLCPVGFYADESQKNCLKCHPSCKKCVDEPERCTVCKEG
FSLARGSCIPDCEPGTYFDSELIRCGECHHTCGTCVGPGREECIHCAKNFHFQDWKCVPA
CGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADE
TFCEMVKSNRLCERKLFIQFCCRTCLLAG
Download sequence
Identical sequences ENSMMUP00000015521 9544.ENSMMUP00000015521 ENSMMUP00000015522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]