SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015625 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015625
Domain Number 1 Region: 27-327
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.64e-88
Family Tail specific protease, catalytic domain 0.00000698
Further Details:      
 
Domain Number 2 Region: 329-632
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.12e-86
Family Tail specific protease, catalytic domain 0.000000024
Further Details:      
 
Domain Number 3 Region: 650-938
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.11e-79
Family Tail specific protease, catalytic domain 0.00000302
Further Details:      
 
Domain Number 4 Region: 939-1129,1161-1230
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.79e-54
Family Tail specific protease, catalytic domain 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015625   Gene: ENSMMUG00000011909   Transcript: ENSMMUT00000016682
Sequence length 1247
Comment pep:known chromosome:MMUL_1:9:48944750:48954673:1 gene:ENSMMUG00000011909 transcript:ENSMMUT00000016682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMREWVLLMSMLLSGLAGPTHLFQPSLVLDMAKVLLDNYCFPENLLGMQEAIQQAIKSHE
ILSISDPQTLASVLTAGVQSSLNDPRLVISYEPSTPEPPPQVPALTSLSEEELLAWLQRG
LRHEVLEGNVGYLRVDSVPGQEVLSMMGEFLVAHVWGKLMGTSALVLDLRHCTGGQISGI
PYIISYLHPGNTILHVDTIYNRPSNTTTEIWTLPQVLGERYGANKDVVVLTSSQTRGVAE
DIAHILKQMRRAIVVGERTGGGALDLRKLRIGESDFFFTVPVSRSLGPLGGGSQTWEGSG
VLPCVGTPAEQALEKALDILTLRSALPGVVHCLQEALKDYYTLVDRVPPLLQHLASMDFS
TVVSEDDLVTKLNAGLQAASEDPRLLVRAIRPRETPSGPVTDAAAEDPPGAAPELPEDDA
IRQALVESVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRH
NPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLL
TSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFID
NHGEAWLGGGVVPDAIVLAEEALDKAQEVLEFHQSLGALVEGTGHLLEAHYARPEVLGQT
SALLRAKLAQGAYRTAVDLESLASQLTADLQEVSGDHRLLVFHSPGELVVEEAPPPPPAV
PSPEELTYLIEALFKTEVLPGQLGYLRFDAMAELETVKAVGPQLVRLVWQQLVDTAALVI
DLRYNPGSYSTAIPLLCSYFFEAEPRQHLYSVFDRATSKVMEVWTLPQVAGQRYGSHKDL
YILMSHTSGSAAEAFAHTMQDLQRATVIGEPTAGGALSVGIYQVGSSPLYASMPTQMALS
ATTGKAWDLAGVEPDITVPMSEALSTAQDIVALRAKVPTVLQTAGKLVADNYASAELGAK
MAVKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIP
SPEVFEELIKFSFHTNVFEDNIGYLRFDMFGDGELLTQVSKLLVEHIWKKIMHTDAMIID
MRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSISELWTHAQVVGTWRSFPLSTV
ILEASGKPGKDSLITRLMYHYARFLEEKKVTSGGCQPPQTYHVDDTNLYLTIPTARSVGA
SDGSSWEGVGVIPHMVVPAEEALTRAKEMLQHNQLRVKRSPGLQDHP
Download sequence
Identical sequences ENSMMUP00000015625 ENSMMUP00000015625 9544.ENSMMUP00000015625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]