SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015702 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015702
Domain Number 1 Region: 242-419
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.59e-42
Family Pentraxin (pentaxin) 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015702
Domain Number - Region: 125-212
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0209
Family Apolipoprotein A-I 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015702   Gene: ENSMMUG00000011970   Transcript: ENSMMUT00000016767
Sequence length 431
Comment pep:known chromosome:MMUL_1:3:45807869:45819377:1 gene:ENSMMUG00000011970 transcript:ENSMMUT00000016767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALLAAIVVLAVAAGAQDSPAPGSRFVCTALPQEAVHAGCPLPAMPMQGGALSPEEELR
AAVLQLRETVVQQKETLGAQREAIRELTGKLARCEGLAGGKARGTGATGKDTMGDLPRDP
GHVVEQLSRSLQTLKDRLESLEHQLRANVSNAGLPGDFREVLQQRLGELERQLLHKVAEL
EDEKSLLHNETSAHRQKTESTLNALLQRVTELERGNSAFKSPDAFKVSLPLRTNYLYGKI
KKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIVLIEWGNNPIELLINDKVAQL
PLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVLILGQEQDTVG
GRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWP
VETCEERLLDL
Download sequence
Identical sequences F7H281
XP_001111081.2.72884 9544.ENSMMUP00000015702 ENSMMUP00000015702 ENSMMUP00000015702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]