SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015793 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015793
Domain Number 1 Region: 23-109
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.57e-31
Family Cytochrome b5 0.0000248
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015793
Domain Number - Region: 116-143
Classification Level Classification E-value
Superfamily Aquaporin-like 0.00419
Family Aquaporin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015793   Gene: ENSMMUG00000012039   Transcript: ENSMMUT00000016863
Sequence length 150
Comment pep:known chromosome:MMUL_1:20:67805080:67844503:1 gene:ENSMMUG00000012039 transcript:ENSMMUT00000016863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHP
GGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPENGSKDPSKHDTCK
SCWSYWILPIIGAVLLGFLYRYYTSESKSS
Download sequence
Identical sequences A0A096NS15 A0A0D9QVW6 A0A2K5WGA0 A0A2K5Y2B7 A0A2K6CHD3 A0A2K6JNH5 A0A2K6QKI4 F7GWE2
ENSMMUP00000015793 NP_001181096.1.72884 XP_007991999.1.81039 XP_010353718.1.97406 XP_011755991.1.29376 XP_011832080.1.47321 XP_017706292.1.44346 ENSPANP00000015835 ENSMMUP00000015793 9544.ENSMMUP00000015793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]