SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015907 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015907
Domain Number 1 Region: 8-84
Classification Level Classification E-value
Superfamily RING/U-box 1.81e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 307-366
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-16
Family SPRY domain 0.0017
Further Details:      
 
Domain Number 3 Region: 94-133
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000128
Family B-box zinc-binding domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015907
Domain Number - Region: 145-203
Classification Level Classification E-value
Superfamily STAT 0.0384
Family STAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015907   Gene: ENSMMUG00000012129   Transcript: ENSMMUT00000016984
Sequence length 394
Comment pep:known chromosome:MMUL_1:4:29734712:29739936:-1 gene:ENSMMUG00000012129 transcript:ENSMMUT00000016984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAASVTSLADEVNCPICQGTLREPVTIDCGHNFCRGCLTRYCEIPGPDLEESPTCPLC
KEPFRPGSFRPNWQLANVVENIERLQLVSTLGLGEEDACQEHGEKIYFFCEDDEMQLCVI
CLHLFMHYVYELCFIFYVPSPQEQIHKCLKCLRKEREEIQEIQSRENKRMQVLLTQVSTK
RQQVISEFAHLRKFLEEQQSILLAQLESLDGDILKQQDEFDFLVAGEICRFSTLIEELEE
KNERPARELLTDIRSTLIRCETRKCRKPVAVSPELGQRIRDFPQQALPLQREMKMFLEKL
HFELDYEPAHISLDPQTSHPKLLLSEDRQRAQFSYKWQNSPDNPQRFDRATCVLAHTGIT
GGRHTWVWMARVPGYSGCFQLSSPPSLLGTEVAE
Download sequence
Identical sequences 9544.ENSMMUP00000015908 ENSMMUP00000015907 ENSMMUP00000015908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]