SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015911 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015911
Domain Number 1 Region: 432-492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000392
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 32-81
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 376-437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000445
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 529-583
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000119
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 296-359
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000772
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 6 Region: 610-666
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000863
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015911   Gene: ENSMMUG00000012131   Transcript: ENSMMUT00000016988
Sequence length 683
Comment pep:known chromosome:MMUL_1:15:58250522:58490355:-1 gene:ENSMMUG00000012131 transcript:ENSMMUT00000016988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRC
LSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCS
LKCQAKGTALVVELAPKVLDGTRCYTESLDICISGLCQIVGCDHQLGSTVKEDNCGVCNG
DGSTCRLVRGQYKSQLSATKSDDAVVAIPYGSRHVRLVLKGPDHLYLETKTLQGAKGENS
LSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSSDSTVQFIFYQPIIHR
WRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCP
ASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKC
MYTPKMPIAQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKP
HIKEECIIPTPCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSTCTVTCGV
GTQVRIVRCQVLLSFSQSVADLPVDECEGPKPASQRACYAGPCSGEIPEFNPDETDGLFG
GLQDFDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTQEPADENLCVTSRRPPQLLKS
CNLDPCPARSSINSAWKACKVLC
Download sequence
Identical sequences F7GZX2
ENSMMUP00000015911 9544.ENSMMUP00000015911 ENSMMUP00000015911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]