SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015931 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015931
Domain Number 1 Region: 560-709
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.16e-66
Family Ankyrin repeat 0.00000175
Further Details:      
 
Domain Number 2 Region: 53-290,322-347
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.29e-65
Family BAR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 438-555
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.59e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.0000053
Further Details:      
 
Domain Number 4 Region: 313-431
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-20
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 5 Region: 1053-1127
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015931   Gene: ENSMMUG00000012145   Transcript: ENSMMUT00000017010
Sequence length 1129
Comment pep:known chromosome:MMUL_1:8:132613894:132751540:-1 gene:ENSMMUG00000012145 transcript:ENSMMUT00000017010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHAT
SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEKALT
MAFRGEQSAGKNSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGI
HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRK
EYITAKYVDHRFSRKTCSTSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSMYSKPECLKLLLRSK
PTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEMDESDDD
LDDKPSPIKKERSPRPQSFCHSSSISPQDKPALPGFSTPRDKQRLSYGAFTNQIFVSTST
DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQK
VALRKTDHLSIDKSNIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPRPQVGDLPPKPG
ELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTPK
SHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQA
DNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Download sequence
Identical sequences ENSMMUP00000015931 9544.ENSMMUP00000015930 ENSMMUP00000015930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]