SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015993 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015993
Domain Number 1 Region: 574-664
Classification Level Classification E-value
Superfamily SAND domain-like 7.85e-35
Family SAND domain 0.0000727
Further Details:      
 
Domain Number 2 Region: 752-853
Classification Level Classification E-value
Superfamily Bromodomain 4.58e-17
Family Bromodomain 0.0034
Further Details:      
 
Domain Number 3 Region: 677-737
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000843
Family PHD domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015993   Gene: ENSMMUG00000012199   Transcript: ENSMMUT00000017079
Sequence length 854
Comment pep:known chromosome:MMUL_1:12:94096193:94187601:1 gene:ENSMMUG00000012199 transcript:ENSMMUT00000017079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQRGQQGQMASGDSNLNSRMVTDTQNTEDQNLQEQVCPEPIFRFFREHKVEIASAITRP
FPFLMGLRDRSFISEQMYEHFQEAFRNLVPVTRVMYCVLSELEKTFGWSHLETLFSRINL
MAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNADHEMGDVAVPQE
ALSSSPRCEPGFSSESCEQLALPNADGGDAEDAPSLLPGGGVSCELAIQTDEGESDEMPT
LLPYDTEVLESNRMTDAARTYSTGPGKKEGDEEGRNSPGKRNQDKEKYQESPAARDRETF
DLKTPQITNEGEPEKGPCLPDEGEEGSDDCSQMCDGEEPQEASSSLARCGSVSCFSAENL
DLKTPQITNEGEPEKALCLLPDEGEEGSDDCSQMCDGEEPQEASSSLARCGSVSGELEDH
PMNEEGESEELASSLLHDDVSGAEQSAYENEKCSCVMCFSEEVPGGPEVKMESDQACGTM
DTVDIGNNSTLGKPKRKKRKKRGHCWTRVRRRMQKNVQQHENSKGNGQVVSNEKKANVNL
KGLSKIRGRKRSKPRTHFTQSDRAPQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGIL
HKKKLKQGILVKCIQSEDGNWFTPREFEIKGGHARSKNWKLSVRCGGWPLRWLIENGFLP
NPPRIYSRKKKRILKSHNNTSVDPCMRNLDECEVCRDGGELFCCDTCSRVFHEDCHIAPV
ETERTPWSCIFCRMKESSGSQQCCQESEVLERQMCPQEQLKCEFLLLKVYCCSESSFFAK
IPYYYYIRETCQGLKEPMWLDKIKKRLNEHSYPQVEGFVQDMRLIFQNHRASYKYKDFGQ
MGLRLEAEFEKNFK
Download sequence
Identical sequences 9544.ENSMMUP00000015997 ENSMMUP00000015993 ENSMMUP00000015997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]