SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016051 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016051
Domain Number 1 Region: 131-454
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.53e-66
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000173
Further Details:      
 
Domain Number 2 Region: 477-607
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.05e-28
Family Ricin B-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016051   Gene: ENSMMUG00000012238   Transcript: ENSMMUT00000017139
Sequence length 608
Comment pep:known chromosome:MMUL_1:3:189041625:189068455:1 gene:ENSMMUG00000012238 transcript:ENSMMUT00000017139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVTVRYFCYGCLFTSATWTVLLFVYFNFSEVTQPLKNVPVKGSGPRGPSPKKFYPRFT
RGPSRLLEPQFKANKIDDVIDSHVEDPEEGHLKFSSELGMIFNERDQELRDLGYQKHAFN
MLISNRLGYRRNVPDTRNAACKEKFYPPDLPAASVVICFYNEAFSALLRTVHSVIDRTPA
HLLHEIILVDDDSDFDDLKGELDEYVQKYLPGKIKVIRNTKREGLIRGRMIGAAHATGEV
LVFLDSHCEVNMMWLQPLLAAIREDRHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHF
KWDLVPLSELGEAEGATAPIKSPTMAGGLFAMNRQYFHELGQYDSGMDIWGGENLEISFR
IWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPD
LKTKSYGNISERVELRKKLGCKSFKWYLDNIYPEMQISGPHAKPQQPIFVNRGPKRPKVL
QRGRLYHLQTNKCLVAQGRPSQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCLDMS
ETRSSDPPRLMKCHGSGGSQQWTFGRPTRLSTVSVGQCLRAVDPLGQKGSVAMAICDGSS
SQQWHLEG
Download sequence
Identical sequences ENSMMUP00000016051 ENSMMUP00000016051 9544.ENSMMUP00000016051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]