SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016079 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016079
Domain Number 1 Region: 254-324
Classification Level Classification E-value
Superfamily Homeodomain-like 2.14e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 97-165
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000428
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 65-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000291
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016079
Domain Number - Region: 161-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00302
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016079   Gene: ENSMMUG00000012259   Transcript: ENSMMUT00000017169
Sequence length 397
Comment pep:known chromosome:MMUL_1:1:172572376:172583795:-1 gene:ENSMMUG00000012259 transcript:ENSMMUT00000017169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGM
PPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYC
KEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSL
VYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIV
NYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTAT
TLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
Download sequence
Identical sequences A0A1D5QN93 A0A2I2Z1J5 A0A2I3LDS6 A0A2I3SPX4 A0A2J8UXV9 A0A2K5JWY5 A0A2K5LNZ1 A0A2K6A320 A0A2K6E6I1 A0A2K6MTM8 A0A2K6R194 E2R2S5 G7NWH8 Q9NQ69
9544.ENSMMUP00000016079 9606.ENSP00000356357 9615.ENSCAFP00000016688 ENSP00000356357 gi|33569216|ref|NP_064589.2| ENSP00000356357 ENSPTRP00000003025 ENSGGOP00000006706 ENSCAFP00000016688 NP_064589.2.87134 NP_064589.2.92137 XP_003264559.1.23891 XP_004415566.1.74151 XP_004685538.1.23501 XP_006749103.1.47382 XP_007987241.1.81039 XP_008974913.1.60992 XP_009438630.1.37143 XP_010356546.1.97406 XP_011744813.1.29376 XP_011787078.1.43180 XP_011825637.1.47321 XP_011891808.1.92194 XP_014976255.1.72884 XP_015303018.1.63531 XP_017751938.1.44346 XP_018893186.1.27298 XP_848787.1.84170 ENSP00000356361 ENSPTRP00000003025 ENSMMUP00000016079 ENSMMUP00000016079 ENSGGOP00000006706 ENSCAFP00000016688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]