SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016106 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016106
Domain Number 1 Region: 20-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.6e-40
Family FCH domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016106   Gene: ENSMMUG00000012277   Transcript: ENSMMUT00000017197
Sequence length 898
Comment pep:known chromosome:MMUL_1:19:17318960:17352809:1 gene:ENSMMUG00000012277 transcript:ENSMMUT00000017197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRHWTGPAGVSTETIRMSYFGEHFWGEKNHGFEVLYHSVKQGPISTKELAEFIRERATIE
ETYSKAMAKLSKLASNGTPMGLFIPQIFIEDCSELRLCHCTPAWTTRAKLLYPRSPLLSL
QCKEEVVGTLDAVQVLSGVSQLLPKSRENYLNRCMDQERLRRESTSQKEMDKAETKTKKA
AESLRRSVEKYNTARADFEQKMLDSALRFQAMEETHLRHMKALLGSYAHSVEDTHVQIGQ
VHEEFKQNIENVSVEMLLRKFAESKGTGQEKPGPLDFEAYSAAALQEMKRLRGAKTFRLP
GLSRREREPEPPAAVDFLEPDSGTCPEVDEEGFTVRPDDLEGPRTAEPSRFSSSDSDFDD
EEPRKFYVHIKPAPARAPACSPEAAAAQLRATAGSLILPPGPGGTMKRHSSRDAAGKPQR
PRSAPRTGSCAERLQSEEQVSKNLFGPPLESAFDHEDFTGSSSLGFTSSPSPFSSSSPEN
VEDSGLDSPSHAAPGPSPDSWVPRPGTPQSPPSCRAPPPEARGIRAPPLTDSPQPLAPSP
GPWGLEALAGGDLMPAPADATAREALAAPPRRLRSRKVSCPLTRSNGDLSRSLSPSPLGS
LAPSTTLERPSFSSQTGHGVSRGPSPVVLGSQDALPVATAFTEYVHAYFRGHSPSCLARV
TGELTMTFPAGIVRVFSGTPPPPVLSFRLVHTAPIEHFQPNADLLFSDPSQSDPETKDFW
LNMAALTEALQRQAEQNPTASYYNVVLLRYQFSRPGPQSVPLQLSAHWQCGATLTQVSVE
YGYRPGATAVPTPLTNVQILLPVGEPVTNVRLQPAATWNLEEKRLTWRLPDVSEAGGSGR
LSASWEPLSGPSTPSPVAAQFTSEGATLSGVDLELVGSGYRMSLVKRRFATGMYLVSC
Download sequence
Identical sequences ENSMMUP00000016106 9544.ENSMMUP00000016106 ENSMMUP00000016106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]